AMPK beta 2 Antibody / PRKAB2

Mfr.No.	R31820
Clonality	Polyclonal
Description	5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE of human AMPK beta 2 were used as the immunogen for the PRKAB2 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Mouse, Rat, Human
Recombinant	No
Subcellular Location	Cytoplasmic

Antigen	AMPK beta 2
Uniprot	O43741

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the PRKAB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, IF, WB, FACS
Dilution	Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/10^6 cells,Immunofluorescence (FFPE): 2-4ug/ml