JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Monoclonal Antibodies

NFIA Antibody

SKU : BHA17109682

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ4923
Clonality	Monoclonal
Description	Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Mouse
Immunogen Region	Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.
Isotype	IgG2b
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Antigen	NFIA
Uniprot	Q12857
Clone No	16H11

Buffer	Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Format	Purified
Purification	Purified
Storage	After reconstitution, the NFIA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IF, FACS, IHC-P, WB
Dilution	Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml, Flow Cytometry: 1-3ug/10^6 cells,Immunofluorescence: 2-4ug/ml

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17109682	RQ4923	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.