JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Monoclonal Antibodies

Ku70/XRCC6 Antibody

SKU : BHA17111024

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ6389
Clonality	Monoclonal
Description	XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Mouse
Immunogen Region	Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD were used as the immunogen for the Ku70/XRCC6 antibody.
Isotype	IgG1
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Antigen	Ku70/XRCC6
Uniprot	P12956
Clone No	3D7

Buffer	Lyophilized from 1X PBS with 2% Trehalose
Format	Purified
Purification	Antigen affinity purified
Storage	After reconstitution, the Ku70/XRCC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	FACS, IF, IHC-P, WB
Dilution	Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17111024	RQ6389	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.