Anti-DOG-1 / TMEM16A / ANO1 Antibody BHA10204290

Mfr.No.	55107-MSM3-P1ABX
Alternative Names	Anoctamin 1 ; Calcium Activated Chloride Channel ; Discovered On Gastrointestinal Stromal Tumors Protein 1 ; TAOS2 ; ORAOV2 ; TMEM16A
Categories	Primary Antibodies
Cellular Localization	Cell Surface, Cytoplasmic
Chromosome Location	11q13.3
Clonality	Monoclonal
Description	Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Host	Mouse
Immunogen	Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Isotype	IgG
Positive Control	Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Reactivity	Human
Recombinant	FALSE
Regulatory	RUO

Swissprot	Q5XXA6
Uniprot	503074
Gene Id	55107

Buffer	200μg/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Concentration	1.0mg/ml
Description	There are no warranties, expressed or implied, which extend beyond this description. Company is not liable for any personal injury or economic loss resulting from this product.
Purity	Purified Ab WITHOUT BSA and Azide at 1.0mg/ml

Applications

FACS, IF, IHC-F

Description

(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes); Optimal dilution for a specific application should be determined., FACS ; IF ; IHC-F

Dilution

FACS	0.5-1μg/million cells in 0.1ml
IF	0.5-1μg/ml
IHC-F	0.25-0.5μg/ml for 30 minutes at RT

Have you used this product?

Rate it now..!!

SKU	Supplier No.	Size	Your price	Quantity
BHA10204290	55107-MSM3-P1ABX	100µg	$393.20		Add to Cart

Anti-DOG-1 / TMEM16A / ANO1 Antibody BHA10204290

Contact us to order

Tel

Email

Contact us to order

Tel

Email

Reviews of Anti-DOG-1 / TMEM16A / ANO1 Antibody BHA10204290

Rate it now..!!