JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Human Recombinant Tau (K18) Delta K280 Mutant PFFs

SKU : BHP11901207

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-477, SPR-477B, SPR-477C, SPR-477E
Alternative Names	Tau PFFs, Tau PFF, Tau protein Pre-formed Fibrils, Tau aggregates, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 4, tubulin-associated unit, MAPT DeltaK280, deltaK280 Tau, K18 delta K280 Tau, truncated deltaK280 Tau
Cellular Localization	Cell membrane, Cytoskeleton, Growth cone, Peripheral membrane protein, Cytoplasm, Axolemma, Axolemma Plasma Membrane, Axon, Cell Body, Cytoplasmic Ribonucleoprotein Granule, Cytoplasmic Side, Cytosol, Dendrite, Microtubule, Microtubule Associated Complex, Neurofibrillary Tangle, Neuronal Cell Body, Nuclear Periphery, Nuclear Speck, Nucleus, Plasma Membrane, Tubulin Complex
Certificate Of Analysis	Certified >95% pure using SDS-PAGE analysis.
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Scientific Background	Alzheimer s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The deltaK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5).
Species	Human
Specificity	~15 kDa
Concentration	Lot/batch specific. See included datasheet.
Purification	Ion-exchange Purified
Expression System	E. coli
Amino Acid Sequence	MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Biological Activity Abreviation	Under Investigation
Cite This Product	Human Recombinant Tau Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-477B)
Nature	Recombinant
Protein Length	Partial

Gross Weight (kg)	1.4
Launch Date	2019/08/28
Net Weight (g)	0.1
Swissprot	P10636
Target Details	Tau (K18) Delta K280 Mutant
Gene Id	4137
Research Area	Tangles & Tau, Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Cytoskeleton
Antigen	Tau

Adr Code	Non-hazardous
Country Of Origin	Canada
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Buffer	PBS pH 7.4
Purity	>95%
Storage	-80 °C
Storage Buffer	PBS pH 7.4
Storage Temperature	-80°C

Applications	In vivo assay, In vitro assay, WB, SDS-PAGE

Reference	1. www.alz.org/alzheimers-dementia/facts-figures 2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146148 (1907) 3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497. 4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174. 5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723.

Product Manual	Datasheet
SDS

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11901207-1	SPR-477B	100 ug	$390		Add to Cart
BHP11901207-2	SPR-477C	100 ug x2	$700		Add to Cart
BHP11901207-3	SPR-477E	100 ug x5	$1455		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.